Terms and Conditions of Sale

1. OUTLINE

1.1 Currency: These terms and conditions of sale (Terms) apply to the supply of all Goods and Services by us (for both Orders made on our website and non- website Orders) to you from the date that you accept these Terms.

1.2 Acceptance: You accept these Terms when:

1.2.1  you submit an Order;

1.2.2  you accept delivery of, or any part of, the Goods and Services of an Order; or

1.2.3  you make Payment, or partial Payment, for any Goods and Services supplied by us, whichever occurs first.

2. FAIR TRADING ACT DISCLOSURE

2.1 For the purposes of section 47A of the Fair Trading Act 1987 (NSW), we disclose to consumers (as defined under the ACL) the substance and effect of certain terms of these Terms:

2.1.1  clause 6.1 requires you to pay a fee if you fail to make any Payment by the due date;

2.1.2  clause 6.4 allows us to terminate your credit account at any time;

2.1.3  clauses 7.6, 8.3 and 11 comprise certain limitations and exclusions of our liabilities;

2.1.4  clause 8.2 imposes certain limitations on you cancelling Orders;

2.1.5  clause 9.5 requires, in relation to the return of Goods, that you pay transportation costs, other costs we incur in connection with the return of the Goods and a restocking fee;

2.1.6  clause 14.2 comprises the grant by you to us of a Security Interest in the Goods supplied by us to you, including all related proceeds, as security for all or part of the payment of any amount relating to the Goods in accordance with these Terms or otherwise;

2.1.7  clause 17.1 comprises an indemnity in our favour for certain claims; and

2.1.8  clause 17.2 allows us to terminate these Terms and any contract for the supply of Goods and/or Services and upon such termination, you must immediately pay any outstanding monies owed to us.

3. QUOTES + ORDERS

3.1  Requesting a Quote: You may request a Quote from us relating to the potential supply of Goods and Services.

3.2  Providing a Quote: We may provide you a Quote for the potential supply of Goods and Services. The Quote may include the price and quantity of the Goods and Services proposed to be supplied by us and other relevant details.

3.3 Validity of Quote: A Quote is valid from the date of issue to the “Valid To:” date as shown on the Quote. We reserve the right to withdraw a Quote at any time before we accept your Order.
3.4 Placing an Order: For:

3.4.1  Non-website Orders: If our Quote is acceptable to you, you may place an Order for the supply of Goods and Services in writing. An Order is binding in accordance with clause 1.2.1 or 1.2.2.

3.4.2  Website Orders: If you place an Order on our Website, the Order is binding upon making Payment or partial Payment in accordance with clause 1.2.3.

3.5 Additional conditions: Unless otherwise agreed by us in writing, these Terms will prevail over, and we will not be bound by, any conditions (express or implied) added or provided by you. We will not be bound by any Order until we have accepted the Order in writing or commenced the supply of the Goods.

4. PRICE

4.1 Price: Our prices are as follows:

4.1.1  Non-Website Price: Unless we otherwise advise in writing and subject to clause 3.2, the price charged and payable for the Goods and Services shall be the price in Australian dollars at the date we provide the Quote or, if there is no Quote, the date of delivery of the Goods or Services to you, together with any applicable taxes, charges and delivery costs regarding the Goods and Services.

4.1.2  Website Price: The price charged and payable for Goods and Services shall be the price in Australian dollars as advertised on our Website on the date you place your Order (inclusive of GST) plus any applicable charges and delivery costs regarding the Goods and Services.

4.2 Variation of price: Prices in any Quote for the supply of Goods or Services are based on the costs prevailing and the specifications supplied at the time of the Quote. Subject to your rights under law, we reserve the right to vary the price if:

4.2.1  there is any movement in the cost of supplying the Goods or Services specified in your Order, including any Charges;

4.2.2  the exchange rate variation exceeds the base rate indicated in the Quote by more or less than the percentage shown in the Quote; or

4.2.3  the Goods or Services specified in your Order are varied from the Goods or Services specified in our Quote, and we provide you reasonable notice of any such variation of price.

4.3 Imported goods: Prices for imported goods charged to you shall be the price of those goods charged to us (including any relevant Charges, transportation, freight and insurance costs) converted into Australian dollars using the applicable daily foreign exchange rate as published by the Reserve Bank of Australia on its website on the date that such goods are invoiced to you.

5. PAYMENT

5.1  Invoice on delivery: Unless we otherwise agree, we will issue you an Invoice upon delivery of the Goods or Services specified in your Order.

5.2  Payment terms: If you have a cash account you must make all Payments in full stated in the relevant Invoice that we issue or if we are offering special terms they will be specified on the Quote.

5.2.1  If you have a credit account, you must make all Payments in full by the end of the month following the date of the Invoice.

5.2.2  If we have revoked your credit, we may request you to pay for any Goods and/or Services in an Order prior to delivery of the Goods and/or Services.

5.3 Payment method: You must make all Payments in cash, by direct credit to the bank account nominated by us, by credit or by cheque or as otherwise indicated by us in writing J A Severn Pty Ltd – Terms + Conditions – June 2021 1

6. PAYMENT DEFAULT

6.1  Administration fee: An administration fee of $50 (inclusive of GST) is payable by you if there is a default in making a Payment on time.

6.2  Costs of enforcement: We may recover from you any costs we incur to collect any Payment.

6.3  No set off: You may not set off against any Payment any claims which you may have against us.

6.4  Revocation of credit: We reserve the right to revoke at any time any credit extended to you because of your failure to make any Payment when due or for any other reason.

7. DELIVERY, RISK + INSURANCE

7.1 Delivery: Delivery of the Goods occurs when you pick up or we deliver of the Goods to you, your agent or nominee or to a carrier commissioned on your behalf at the place specified by you, or as otherwise agreed. If not already provided in your Order, you shall provide to us any forwarding instructions at the time of ordering or at least 7 business days before the date set for Delivery of the Goods.

7.2 Cost of delivery: We may charge you the cost of delivering the Goods to you, which will be included in the Quote. You must pay for any further costs after the Goods have been Delivered.

7.3 Instalments: We reserve the right to make deliveries in instalments and these Terms shall be severable as to such instalments, in which case Payment for each instalment is a condition precedent to subsequent instalments.

7.4  Risk passes on delivery: The risk in the Goods shall pass to you upon the delivery of the Goods in accordance with clause 7.1.

7.5  Insurance over Goods: You must from the delivery date until we have received Payment for all Goods in full have sufficient insurance in respect of the Goods to protect us against loss or damage by fire, theft, or any other cause whatsoever and provide to us upon our request evidence of such insurance.

7.6 No liability for delay: We will use reasonable efforts to deliver the Goods to you by the date and to the place specified by you. Without limiting clause 11 (Exclusions + Limitations), if the Delivery of the Goods is delayed:

7.6.1  we shall not be liable for any expenses you incur due to late delivery or delay in delivery unless we agree to do so and if it is shown as such on the quote; and

7.6.2  the delay does not give you the right to cancel an Order or terminate these Terms.

7.7 Backorders: When an order is a combination of Goods in stock and backordered Goods, delivery will be made when the backordered Goods are available and ready for delivery.

8. SUSPENSION + CANCELLATION

8.1 Suspension of Order: If as a consequence of your instructions we delay or suspend (but not cancel) an Order or any part of an Order for a period of 7 days or more, we may:

8.1.1  request the payment in full for all work in progress relating to the relevant Order at the time of suspension; and/or

8.1.2  vary the price for the uncompleted portion of the relevant Order.

8.2 Cancellation by you: You may not cancel an Order, or any part of it, unless:

8.2.1  we give our written consent; and

8.2.2  you pay to us (if required by us in our absolute discretion) any and all costs reasonably incurred by us regarding the cancelled Order or the cancelled part of the Order to the date of cancellation.

8.3 Cancellation by us: We may in writing or verbally cancel an Order or delivery of an Order without liability to you if:

8.3.1  we reasonably form the opinion that you are insolvent or at material risk of insolvency;

8.3.2  you fail to make a Payment on time; or

8.3.3  we reasonably form the opinion that supplying Goods or Services to you may have a negative impact upon our business or commercial reputation or image.

10. EXPRESS WARRANTY

10.1 Provider details: The warranty against defects (Warranty) contained in this clause 10 is provided by:

J A Severn Pty Ltd

Unit 4/8A Kookaburra Road

Hornsby Heights

New South Wales 2077

Australia

Tel: +61 2 9482 1944

10.2  Warranty: Subject to clause 11.7, we warrant that the Goods supplied by us are supplied free from defects in material and workmanship.

10.3  Warranty Period: The Goods are covered by this Warranty for a period of 12 months from the date of delivery unless otherwise stated in writing. If there is no Quote, the warranty period will depend on the Goods and/or Services provided and will be stated to you in writing at the time the Goods and/or Services are provided as well as in the invoice for the Goods and/or Services provided. We offer the same warranty on any Goods we supply as offered by the manufacturer of the Goods which you may access on the manufacturer’s website or request from us.

10.4 Exclusions: We will not be liable for:

10.4.1  loss or damage caused by factors beyond our control;

10.4.2  any Goods that have not been installed, commissioned, assembled, integrated and maintained according to maintenance or care instructions in accordancenwith the original manufacturer’s instructions;

10.4.3  any alterations or repairs to the Goods not performed by us or with our prior written consent;

10.4.4  damage or defects caused to the Goods due to unusual, non-recommended or negligent use of the Goods; or

10.4.5  loss or damage incurred in connection with transportation or delivery of the goods.

10.5 Making a claim: You must make a claim under this Warranty by providing us notice in writing within 14 days to our address specified in clause 10.1 containing reasonable description of the defect in the Good(s).

10.6 Replacement part warranty: A replacement part supplied by us during the warranty period shall be covered by the warranty for the unexpired portion of the warranty period which covered the original Goods.

10.7 Regulation 90: This Warranty against defects is provided in addition to other rights and remedies you may have at law.

10.7.1  Goods only: Our goods come with guarantees that cannot be excluded under the Australian Consumer Law. You are entitled to a replacement or refund for a major failure and compensation for any other reasonably foreseeable loss or damage. You are also entitled to have the goods repaired or replaced if the goods fail to be of acceptable quality and the failure does not amount to a major failure.

10.7.2  Services only: Our services come with guarantees that cannot be excluded under the Australian Consumer Law. For major failures with the service, you are entitled:

A  to cancel your service contract with us; and

B  to a refund for the unused portion, or to compensation for its reduced value

You are also entitled to be compensated for any other reasonably foreseeable loss or damage. If the failure does not amount to a major failure, you are entitled to have problems with the service rectified in a reasonable time and, if this is not done, to cancel your contract and obtain a refund for the unused portion of the contract.

10.7.3  Goods & Services: If you are a consumer for the purposes of the ACL, the following statement applies to you. Our Goods come with guarantees that cannot be excluded under the Australian Consumer Law. For major failures with the service, you are entitled:

A  to cancel your service contract with us; and

B  to a refund for the unused portion, or to compensation for its reduced value.

You are also entitled to a refund or replacement for major failures with Goods. If a failure with the Goods or a Service does not amount to a major failure, you are entitled to have the failure rectified in a reasonable time. If this is not done you are entitled to a refund for the Goods and to cancel the contract for the Service and obtain a refund of any unused portion. You are also entitled to be compensated for any other reasonably foreseeable loss or damage from a failure in the Goods or Service.

11. EXCLUSIONS + LIMITATIONS

11.1  ACL exception: The exclusions and limitations in this clause 11 are subject to clause 12 (Statutory Rights).

11.2  Excluded rights: All express or implied representations, conditions, statutory guarantees, warranties and provisions (whether based on statute, common law or otherwise), relating to these Terms, that are not contained in it, are excluded to the fullest extent permitted by law.

11.3 Limitations: No warranty is given and we will not be liable for:
In the case of Goods

11.3.1  alterations to Goods for which we are not responsible;

11.3.2  defects or depreciation caused by wear and tear, accidents, corrosion, dampness, abnormal conditions or effects;

11.3.3  defects or damage caused in whole or in part by misuse, abuse, neglect, electrical or other overload, nonsuitable lubricant, improper installation or alteration or accident;

11.3.4  defects caused as a result of a contractor you have instructed to service our installation;

11.3.5  damage or failure caused by unusual or non-recommended use, misuse or application of the Goods; or

11.3.6  loss caused by any factors beyond our control; and In the case of Services

11.3.7  interference with our Services for which we are not responsible;

11.3.8  damage or loss caused by unusual or non-recommended use of our Services; or

11.3.9  loss caused by any factors beyond our control.

11.4 Indirect loss: We will not be liable for any special, indirect, consequential or economic loss or damage or loss of profits (in contract or tort or arising from any other cause of action) suffered by you or any other person resulting from any act or omission by us (including breach, termination or non-observance of the terms of an Order or agreement which incorporates these Terms).

11.5 Total liability: Our total liability for breach of these Terms or breach of our contractual obligations or duties at law or in equity (however arising) is limited at our option to:
In the case of Goods

11.5.1  the replacement of the Goods or the supply of equivalent goods;

11.5.2  the repair or rectification of the Goods; J A Severn Pty Ltd – Terms + Conditions – June 2021 3

11.5.3  the payment of the cost of replacing the Goods or of acquiring equivalent goods; or

11.5.4  the payment of the cost of the repair or rectification of the Goods; and In the case of Services

11.5.5  the supply of the Services again; or

11.5.6  the payment of the cost of having the Services supplied again.

11.6 No reliance: You agree that:

11.6.1  you have and will make your own assessment of the fitness for purpose and suitability of any Goods or Services supplied to you;

11.6.2  you do not and will not rely on our skill or judgment nor that of any person by whom any prior arrangements regarding the acquisition of any Goods or Services were or will be made; and

11.6.3  you have not made nor will make known to us or a manufacturer of goods (directly or indirectly) the particular purpose for which you acquire Goods or Services.

11.7 Third party work: If we obtain goods or services from a third party to carry out your instructions or complete an Order:

11.7.1  we will not be liable for any breach of these Terms if that breach is as a result of or is connected with the supply by a third party of such goods or services;

11.7.2  we acquire such goods or services as agent for you not as principal and will have no liability to you regarding the supply of these goods or services;

11.7.3  any claim by you regarding the supply of such goods or services must be made directly against that third party; and

11.7.4  you must pay for such goods or services from the third party plus the cost of or relevant fee for us performing such services as agent for you (whether separately identified or not). You do not require us to account to you for any commissions or benefits we may receive from such a third party supplier in connection with the supply of such goods or services to you and authorise us to contract on your behalf as we think fit.

11.8 We give no warranty in respect of any goods or services that are supplied or carried out or provided to you by a third party even where forming part of an Order. Any warranties or other rights will be governed by the terms of supply by that provider to you and relevant laws.

12. STATUTORY RIGHTS

12.1 Statutory rights: Certain statutory guarantees, warranties and rights may apply to your purchase of Goods and Services from us as provided by relevant laws but subject to these Terms as applicable and where permitted by relevant laws.

12.2 No restriction: Nothing in these Terms excludes, restricts or modifies any condition, warranty, statutory guarantee, right or remedy implied or imposed by common law, statute or regulation which cannot be lawfully excluded, restricted or modified.

12.3 Unfair contract: If section 23 of the ACL applies to any provisions in these Terms, any such provision(s) shall be void to the extent it is unfair within the meaning of section 24 of the ACL.

13. TITLE

13.1  Subject to the PPSA: The provisions of this clause 13 are subject to the provisions of the PPSA and clause 14 (Security Interest).

13.2  Possession as bailee: After delivery of the Goods, until the full Payment has been made you shall possess the Goods as bailee only.

13.3  Title: We will retain absolute title over the Goods until:13.3.1  we have received Payment in full in respect of the Goods; or13.3.2  the Goods are disposed of in the manner prescribed under clause 14.

11.13.4 Identification: Until full title in the Goods has passed to you, you will ensure that:

13.4.1  any identifying plate, mark or packaging number on any of the Goods is not removed, defaced or obliterated; and

13.4.2  the Goods are identifiable and distinguishable from any other goods that may be in your possession and as to each particular Invoice of Goods.

14. SECURITY INTEREST

14.1  Security Agreement: This clause 14 sets out the Security Agreement between you (as grantor) and us (as secured party).

14.2  Creation of Security Interest: You grant to us a security interest (Security Interest) in the Goods supplied by us to you, including all related proceeds (Collateral), as security for all or part of the Payment of any amount relating to the Goods in accordance with these Terms or otherwise. For the avoidance of doubt, this Security Interest is also a Purchase Money Security Interest in the Collateral.

14.3  Ranking: Subject to the priority rules set out in the PPSA, this Security Interest ranks in priority ahead of all other security interests in the Collateral.

14.4  Continuing obligation: This Security Interest is a continuing security and your obligations under this Security Agreement continue until it has been validly and fully terminated.

14.5 Perfection: You irrevocably give us authority to register a financing statement for the Security Interest on the PPSR. This clause does not prevent us from perfecting this Security Interest by any other means in accordance with the PPSA.

14.6 Information: You must provide us with any information required for us to register a financing statement or a financing change statement for this Security Interest on the PPSR.

14.7 Identification: Until this Security Interest has been extinguished, you must ensure that, as far as is reasonably practicable:

14.7.1  any identifying plate, mark or packaging number on any of the Collateral (including Goods) is not removed, defaced or obliterated; and

14.7.2  the Collateral is identifiable and distinguishable from any other goods or products in your possession and as to each particular Invoice of Goods comprising the Collateral.

14.8  Accessions: You acknowledge that this Security Interest continues to apply to Collateral that becomes an accession to other goods.

14.9  Remedies: Until this Security Interest in the Collateral has been extinguished, if:

14.9.1  you experience a Default Event; or

14.9.2  you breach these Terms, we may as we see fit and without notice to you, seize, retain or redeem the Collateral, or seek any and all remedies provided under Chapter 4 of the PPSA or any other remedies provided at law or in equity, including those set out in clause 14.10.

14.10 Right of entry: In additional to any rights given to us under Chapter 4 of the PPSA, you irrevocably: 14.10.1 grantustherightto: A  demand the immediate return of the Goods to us; B  enter your premises to search for and seize the Goods without notice or liability to you; and C retain, sell or otherwise dispose of those Goods in any manner we see fit; and 14.10.2 indemnifyanduskeepindemnifiedagainstanyclaim(includinginnegligence)inrespectofanydamagetoyourpropertyorthepremisesyouoccupiedorany consequential loss caused by another party arising relating to searching for and seizing any Goods in accordance with this clause 14.10.

14.11 Permitted use and sale: You may only sell or deal with any of the Collateral (including accessions) in respect of which full Payment has not been received if:

14.11.1  wehavenotexercisedaremedyunderthisSecurityAgreement;

14.11.2  theproposedtransactionisabonafidetransactiontoathirdpartyatmarketvalueconductedintheordinarycourseofyourbusiness;

14.11.3  theproposedtransactiondoesnotcreateasecurityinterestintheCollateralthatranksabovethisSecurityInterest;

14.11.4  allproceedsoftheproposedtransactionis:

A  immediately paid to us; or

B  held on trust for us in a separate account, payable on demand; and

14.11.5  unlessotherwiseobligatedbylaw,youdonotdisclosetoathirdpartythattheproposedtransactionissubjecttothisSecurityAgreementorthattheproceeds will be immediately paid to us or held on trust for us.

14.12 Costs: You must pay all costs incurred by us (including costs on a solicitor-client basis and debt collector’s costs) arising out of this Security Agreement, including costs regarding:

 14.12.1  seizure,retention,redemptionoranyotherremedyexercisedpursuanttothisSecurityAgreement;and

14.12.2  theenforcementofourrightsunderthisSecurityAgreement(includingmattersincidentaltoit).

14.13  Extinguishment: The Security Interest is extinguished only if all obligations under this Security Agreement have been satisfied.

14.14  Waiver: Sections 95, 118, 121(4), 125, 130, 132 and 135 of the PPSA shall not apply to the extent that they impose obligations on us.

14.15  Waiver of receipt of statements: You irrevocably waive your to receive from us a copy of any financing statement, financing change statement or verification statement that is registered, issued or received at any time regarding this Security Agreement.

14.16 Disclosure: The parties agree that neither party may disclose information that:

14.16.1  canberequestedundersection275(1)ofthePPSA(subjecttoanyexceptionsthatmayapplyundersection275(7)ofthePPSA);or

14.16.2  isprotectedagainstdisclosurebyadutyofconfidence.

14.17 Acknowledgement: You acknowledge due notice of this Security Agreement with acceptance of these Terms.

15. INTELLECTUAL PROPERTY

15.1 Your intellectual property: If you provide us with Material to be used in the supply of the Goods or Services:

15.1.1  you warrant and represent to us that our use of any Materials will not infringe the Intellectual Property Rights of any third party; and

15.1.2  you indemnify and will keep us indemnified from and against any and all claims, liabilities, obligations, expenses or damages which we may incur if clause 15.1.1 is untrue or breached.

15.2 Licence over Materials: You grant to us a non-exclusive royalty-free license to use all Intellectual Property Rights in all Materials for so long as necessary or convenient for the production of the Goods or Services and the matters contemplated regarding the delivery of the relevant Goods or Services.

15.3 Our intellectual property: All of our Intellectual Property Rights in and relating to the production, development and supply of the Goods or Services, including but not limited to drawing, illustrations, specifications, and other related literature (excluding Materials licensed to us pursuant to clause 15.2) remains our property and shall not be transferred, assigned, licensed, reproduced, disclosed or otherwise given to any other person by you without our prior written consent.

15.4 Confidentiality: You must keep confidential and shall not use any of our confidential information without our prior written consent.

16. GST

16.1  Prices exclusive of GST: Unless otherwise agreed, prices are exclusive of GST.

16.2  GST payable in addition: You must pay to us all GST in addition to any other amounts payable by you to us in respect of a taxable supply, which will be payable by you when required to pay for the Goods or Services.
16.3 Issue of tax invoice: We will issue a tax invoice for any taxable supply to you, which will enable you, if permitted by the GST Law, to claim a credit for GST paid by you.

16.4  Third party supplies: If GST is payable for a taxable supply by a third party, we will request that party to provide you with a tax invoice.

16.5  GST Applicable: GST will only be applied to transactions as per the ATO guidelines.

17. GENERAL

17.1 Indemnity: You agree to indemnify and keep us indemnified in respect of all damages, losses, costs and expenses (including legal costs) that we may incur as a result of your breach or alleged breach of these Terms.
17.2 Termination: If a Default Event occurs:

17.2.1  we may, without limiting any other right we have under these Terms, terminate any outstanding Order and any contract for the supply of Goods and/or Services to you; and

17.2.2  all Payments and any other monies due under these Terms become immediately payable.

17.3 Conditions of use: You acknowledge and accept that any Goods you purchase from us may not be used in the design, development, production of or use of nuclear, chemical or biological weapons or ballistic missiles or in a facility engaged in such activities, unless you have express permission to do so by the Australian Federal Government.

17.4  Lawful purpose: You must ensure the Goods and Services are used only for lawful purposes and in accordance with applicable laws.

17.5  Binding: These Terms bind our successors, administrators and permitted assigns and your executors and permitted assigns or your successors, administrators and permitted assigns (as applicable).
17.6 Assignment: We may without notice to you assign, transfer and/or sub-contract our rights and/or obligations (in whole or in part) under these Terms. You may not assign, transfer, hold on trust or otherwise delegate any of your rights or obligations under these Terms without our prior written consent.

17.7  Time of the essence: Time is of the essence for any date or period under these Terms.

17.8  New Terms: If we adopt new terms and conditions for the sale of Goods and Services:

17.8.1  you will be given written notice; and

17.8.2  they will apply to the subsequent supply of Goods and Services.

17.9  Variation: We may vary these Terms by providing you 14 days’ written notice.

17.10  Force Majeure: If a Force Majeure Event occurs, we may:

17.10.1 totally or partially suspend any Order or any deliveries relating to an Order during any period in which we may behindered due to that Force Majeure Event; and

17.10.2 electtoextendatourdiscretiontheperiodforperformanceofanobligationundertheseTermsasisreasonableinallthecircumstances.

17.11 Severability: Each clause in these Terms is severable and if any clause is held to be illegal or unenforceable, then the remaining clauses will remain in full force and effect.

17.12 Waiver: No failure, delay, relation or indulgence on our part in exercising any power, right or remedy precludes any other or further exercise of that or any other power, right or remedy.

17.13 Privacy: By accepting these Terms, you acknowledge that you have read and accept the terms in our Privacy Policy which is located in the Policies & Statements Area of our Website.

17.14 Governing law: These Terms shall be governed by the laws of the State of New South Wales and the parties irrevocably submit to the non-exclusive jurisdiction of the Courts of the State of New South Wales.

18. INTERPRETATION + DEFINITIONS

18.1 Personal pronouns: Except where the context otherwise provides or requires:

18.1.1  the terms we, us or our refers to J.A. Severn Pty Ltd and its Businesses; and

18.1.2  the terms you or your refers to any person or entity that places an Order with us and agrees (by conduct, notice or otherwise) to be bound by these Terms, including any related company, related party, officer and authorised person of the relevant person.

18.2 Defined terms: In these Terms, unless otherwise provided, the following terms shall have their meaning as specified: ACL means the Australian Consumer Law under the Consumer and Competition Act 2010 (Cth) as amended. ATO means Australian Tax Office of the Australian Government.

Businesses means:

(a)  Clarke & Severn Electronics; and

(b)  Clarke & Severn Electronic Solutions.

Charges means any sales tax, excise duties, customs duty, transfer duty, GST or any other taxes, duties or charges applicable in respect of the provision of the Goods and Services.

Clarke & Severn Electronics or Clarke & Severn Electronic Solutions means J A Severn Pty Ltd (70 001 360 836) trading as Clarke & Severn Electronics or Clarke & Severn Electronic Solutions of Unit 4/8A Kookaburra Road, Hornsby Heights, New South Wales 2077.

Default Event means any one of the following events:

(a)  you fail to make any payment when due, whether for the Goods and Services or otherwise;(b)  if you are a person – you become an insolvent under administration;(c)  if you are a body corporate – you become an externally administered body corporate;(d)  proceedings or applications are commenced or made for the appointment of any persons listed in items (b) or (c) above; or(f) a mortgagee or their agent enters into possession of your assets.

Default Interest means as defined in clause 6.

Delivery means the delivery of the Goods and Services in accordance with clause 7.1.

Force Majeure Event means circumstances beyond our reasonable control, which shall include, but not be limited to compliance with any laws, regulations, orders, acts, instructions or priority request of any government, or any department or agency, civil or military authority, acts of God, acts of the public enemy, your acts or omissions, fires, floods, strikes, lockouts, embargoes, wars, epidemic, labour or material shortages, riots, insurrections, defaults of our suppliers or subcontractors, delays in transportation, loss or damage to Goods in transit or instructions or lack of instructions from you.

Goods means cables, connectors, guitar products, pro audio components, cable, pro audio equipment, RF microwave equipment or components, spacers/standoffs, switches, thermal interface or EMI materials and any other products offered by us from time to time.

GST and GST Law mean as defined in the A New Tax System (Goods and Services Tax) Act 1999 (Cth).

Intellectual Property Rights means all forms of intellectual property rights (whether registered or unregistered) in copyright, designs, patents, trade marks, domain names, trade secrets, know-how, confidential information, and all other similar proprietary rights which currently exist and/or are recognised in the future.

Invoice unless otherwise agreed means the invoice issued upon the delivery of the Goods and Services specified in your Order.

Material means any material in which you have Intellectual Property Rights provided by you for use by us in the production and development of the Goods and Services to you.

Order means an order for Goods and Services received by us whether in writing or otherwise.

Payment means payment of any amount relating to Goods or Services in accordance with these Terms.

PPSA means the Personal Property Securities Act 2009 (Cth) as amended, including any regulations made pursuant to it.

PPSR means the Personal Property Securities Register.

Quote means a quotation by us for the supply of particular Goods and Services containing details as specified in clause 2.2.

RMA means return merchandise authorisation provided by us authorising the return by you of the defective Goods to us.

Security Agreement means the security agreement set out in clause 14 (Security Interest).

Services includes the provision of cable and product assembly and any other services offered or performed by us from time to time.

Website means http://www.cseonline.com.au/, http://www.clarke.com.au/ and any other websites established and used by us from time to time.

J A Severn Pty Ltd – Terms + Conditions – June 2021 6